SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917109|ref|YP_002930626.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917109|ref|YP_002930626.1|
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.28e-29
Family HD domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917109|ref|YP_002930626.1|
Sequence length 161
Comment hypothetical protein EUBELI_01179 [Eubacterium eligens ATCC 27750]
Sequence
MINRLHMAMIELYKGDAKRIQHFCKVHSYAKLIAQMENVDDKCLFIIETAALTHDIGIHT
CEEKYGECGGKLQEKEGPAIAAGLLDRLGFDSEVSERVQYLIGHHHTYNNIDGIDYQILV
EADFLVNICDDNLTKDAALKAYNNIFKTESGKKICQEMFGL
Download sequence
Identical sequences C4Z0R6
gi|238917109|ref|YP_002930626.1| 515620.EUBELI_01179 WP_012739414.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]