SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917116|ref|YP_002930633.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917116|ref|YP_002930633.1|
Domain Number 1 Region: 77-302
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 2.35e-87
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.000000522
Further Details:      
 
Domain Number 2 Region: 3-77,314-512
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.75e-71
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917116|ref|YP_002930633.1|
Sequence length 516
Comment phosphoglyceromutase [Eubacterium eligens ATCC 27750]
Sequence
MSKKPVVLMVLDGYGLNDRTEGNAIAMANTPVMDKLMKECPFQKGYASGLAVGLPDGQMG
NSEVGHMNIGAGRIIYQDLTRITKDIEDGTFFKNEELLEAMENCKKNDSDLHLFGLLSDG
GVHSHLSHVYGLLEMAKQQGVSKVYVHAFLDGRDTPPASAKGFVETLENKMAEIGVGKVA
SLSGRYYAMDRDNNWDRVEKAYDSLVTGDGIKAESATQALQESYDNGKTDEFVEPTVICK
DGQPLSLVKANDSVIFFNFRPDRAREMTRAFCDDKFTGFERKTGFIPLTFVCFKDYDESI
PNKKVAFKKEIIKNTFGEFLANHGKKQLRLAETEKYAHVTFFFNGGVEDPNVDEFRLLVN
SPKDVATYDLKPEMSAPEVGMDLVEAIKSDKYDVIIINFANPDMVGHTGVIPAAIKAVEK
VDELVGKAVDAVKDVDGVLFICADHGNAEKMIDYETGAPHTAHTTNPVPFILVNYDENYT
LREGGRLCDIAPTLIEIMGLEKPVEMTGESLLVKKN
Download sequence
Identical sequences A0A174Z0Q8 C4Z0S3
gi|238917116|ref|YP_002930633.1| WP_012739421.1.40640 WP_012739421.1.74791 WP_012739421.1.89035 515620.EUBELI_01187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]