SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917122|ref|YP_002930639.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917122|ref|YP_002930639.1|
Domain Number 1 Region: 2-363
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.63e-84
Family Amylase, catalytic domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 372-434
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000117
Family alpha-Amylases, C-terminal beta-sheet domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917122|ref|YP_002930639.1|
Sequence length 436
Comment glycoside hydrolase family 13 protein [Eubacterium eligens ATCC 27750]
Sequence
MWYEEAVFYQVFPLGFCDGLRDNDGVMNRCISEFADWIPHLQKLGTDAVYFSPIFESDYH
GYDTRDYRVIDKRIGTNKNFAELVSKLHEAGIKVVIDGVFNHVGRGFFAFKDVCEKKWDS
AYKDWFNISFDGNSPYNDGFWYEGWEGYYNLVKLNLNNQDVVNYLIESVRGWVNEFDIDG
IRLDVAYCLNRDFMKRLRYETDQMKQEFFLVGEMLHGDYNTIVGDECLHSATNYECYKGL
YSSFNSMNMFEIAHSIERQFGKEPWCLYTGKHLLTFVDNHDVSRIASTLTNKAHLPLIYA
LMFGMPGIPCIYYGSEWGCEAVKGSGNDNILRPAFDKPEYNELTDTISSLGQMYHNSRAL
SYGDYTKKVLTNRQYVFKREADGEKVLVAINADENEYTAYFDTECADALNLITGKKEELS
GKIVLPSYSFRFYRCM
Download sequence
Identical sequences C4Z0S9
515620.EUBELI_01193 gi|238917122|ref|YP_002930639.1| WP_012739427.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]