SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917130|ref|YP_002930647.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917130|ref|YP_002930647.1|
Domain Number 1 Region: 2-314
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 2.01e-89
Family Adenylation domain of NAD+-dependent DNA ligase 0.00000165
Further Details:      
 
Domain Number 2 Region: 404-586
Classification Level Classification E-value
Superfamily RuvA domain 2-like 5.56e-49
Family NAD+-dependent DNA ligase, domain 3 0.00022
Further Details:      
 
Domain Number 3 Region: 595-669
Classification Level Classification E-value
Superfamily BRCT domain 5.09e-19
Family DNA ligase 0.0017
Further Details:      
 
Domain Number 4 Region: 316-397
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000024
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917130|ref|YP_002930647.1|
Sequence length 669
Comment DNA ligase (NAD+) [Eubacterium eligens ATCC 27750]
Sequence
MDLLQEYSELKKTIDYHMDRYYNQDEPEISDYEYDKLMIRLKEIEKEHPEWVTSDSPSQK
IGGTVKREAGVKVTHNVPMLSIEDVFSEDAVCAWVDKVHAMHPDCTFSVETKIDGLSMSL
RYVKEADGKLHLHLAETRGDGLIGEDVTANARVVGDVLQVIDLPYDSLELRGEVYMSHED
FEKYNEEQERLEKKTAANPRNLAAGTLRQLDTSITKKRGLKIFIFNVQDGPDEIMESHGR
GMDILKAAGVPVVYHKICKTKEEVVRAIDEIGRMREELPYDIDGAVVKIDHIAFRQEFPA
GSKYSSGHIAYKYPPEEKVIVMDDILVDVGRTGKLTFTGIFHDPETGKPARLCGTSVSRA
TLHNQDYITQMNVGIGGEYKLFKSGEIIPKLNGCVKAPEHVFEAPKVCPVCGEPLIREED
TADIRCVNPSCAAQLSRTVAYFTSLDCMNIMGLGETLVDALIKDGYIHNYADIYALKEHR
DELIEKGIIGKEKNTDKLLAAIEKSKENTPDRLLTALGIRNVGKNTAKQIMNYYDNLMEL
ADAGEEELQNIPDIGATTAKCIHDFFHDEANIELLERLKQSGLNMQMPEKKEMSDKLEGK
TIVVTGSFDNYSRKDMEELIVSNGGKATGSVSKKTDYLVAGEAAGSKLDKANSLGVKVLT
IDEFMEMIK
Download sequence
Identical sequences C4Z0T7
gi|238917130|ref|YP_002930647.1| WP_012739435.1.74791 515620.EUBELI_01201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]