SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917147|ref|YP_002930664.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917147|ref|YP_002930664.1|
Domain Number 1 Region: 399-634
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 2.14e-80
Family Type II DNA topoisomerase 0.00023
Further Details:      
 
Domain Number 2 Region: 5-216
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.38e-68
Family DNA gyrase/MutL, N-terminal domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 224-392
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.36e-44
Family DNA gyrase/MutL, second domain 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917147|ref|YP_002930664.1|
Sequence length 638
Comment DNA gyrase subunit B [Eubacterium eligens ATCC 27750]
Sequence
MAANKYDANSISILEGLEAVRMRPGMYIGSVGTKGLNHLIYEIADNSVDEHLAGFCTQIN
VTLNDDGTATIKDNGRGIPIGIHPKAGIPAVEVVFTVLHAGGKFGDGGYKISGGLHGVGA
SVVNALSVWLEVEIRVDGGVYKQRYERGKATAPLEKIGTCRKNDTGTTVTFLPDGEIFEK
TRFKADSIKSRLHETAYLNPGLTIEFEDKRKGSEDKETFHEPDGLKAYIKDLNNGKETVC
DIVYFKKKQEDIEVEVAFQFVNEFEENILGFCNNIYTQEGGTHITGFKTKFTMIINQYAR
ELGILKDKDANFTGLDVRNGMTAVVAVKHPAPRFEGQTKTKLDNPDAGTVVANVTGDEVQ
LYFDRHLDDLNAVIACAEKSAKIRKAEEKAKTNMLTKQKFSIDSNGKLANCESKNPEECE
VFIVEGDSAGGSAKTARNRRTQAILPIRGKILNVEKASIDKVLANAEIKTMINSFNCGFL
EGYGNDFDISRLRYNKIIIMTDADVDGAHIDTLLLTFFYRFMPELINQGHVYIATPPLYK
VVPKKGEGEYLYDDKALEDYRKKHTSGTFTLQRYKGLGEMDPDQLWETTLNPETRILKQV
EIEDARLATEVTAMLMGTDVPPRREFIYTHANEAEIDA
Download sequence
Identical sequences C4Z0V4
515620.EUBELI_01219 gi|238917147|ref|YP_002930664.1| WP_012739452.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]