SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917165|ref|YP_002930682.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917165|ref|YP_002930682.1|
Domain Number 1 Region: 192-242
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000816
Family AraC type transcriptional activator 0.074
Further Details:      
 
Domain Number 2 Region: 142-190
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000116
Family AraC type transcriptional activator 0.07
Further Details:      
 
Domain Number 3 Region: 3-119
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.00000144
Family Regulatory protein AraC 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917165|ref|YP_002930682.1|
Sequence length 249
Comment two-component system response regulator YesN [Eubacterium eligens ATCC 27750]
Sequence
MMHGNCTISIDNRLFTLSEGNIIFIPANSVHRTSYIGELVPERTYIEFSKDYIETISQTL
GKNWAEHNLWGHILYIEKEKREKIDFLFREIQKEYDIVDGYSDCCIRQLFQYLIINLIRL
DRNTKDIKEFITNSDNKINQNMIIAAKYIAENFKNDITLKDVASHLNLNPSYFSSKFKAF
NNIGFAEYLRNIRVNHAEWYLIETDLSLSDIASECGFCNSNYFGDTFKLVNGISPSEFRK
NNKPKKAEN
Download sequence
Identical sequences C4Z0X2
515620.EUBELI_01238 gi|238917165|ref|YP_002930682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]