SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917171|ref|YP_002930688.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917171|ref|YP_002930688.1|
Domain Number 1 Region: 51-214
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 6e-24
Family GlmU C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917171|ref|YP_002930688.1|
Sequence length 223
Comment UDP-N-acetylglucosamine pyrophosphorylase [Eubacterium eligens ATCC 27750]
Sequence
MNNDALKISNLYDLNETIAAKVFEGCTYPWEVLAKIGDFIVELGNTLPEDEYEKRGENIW
VHRTANVFPSAYIAGPAIIGKDAEVRHCAFIRGKAIVGEGAVVGNSTELKNVILFNKVQV
PHYNYVGDSILGFKAHMGAGSITSNVKSDKKLITIKGPDCNIDTGIKKIGAFLGDNVEVG
CGSVLNPGTIVGRESNIYPLSSVRGFIPAGSIYKKQGEVVTKR
Download sequence
Identical sequences C4Z0X8
515620.EUBELI_01244 gi|238917171|ref|YP_002930688.1| WP_012739476.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]