SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917210|ref|YP_002930727.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917210|ref|YP_002930727.1|
Domain Number 1 Region: 9-360
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.1e-68
Family Homocysteine S-methyltransferase 0.0000115
Further Details:      
 
Domain Number 2 Region: 316-591
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.47e-54
Family Methylenetetrahydrofolate reductase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917210|ref|YP_002930727.1|
Sequence length 595
Comment bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein [Eubacterium eligens ATCC 27750]
Sequence
MKYTGTAGILYDRLKSEILVADGAFGTYYAKKYDTGSLPELANLQASDRVLAIHKEYIEA
GAKIIRTNTFASNTVCLGAGFDEVRNNIKNAVDIAREAVKGTDVLVAADIGPIPGENMIE
KEHIEKEYVDIVNVFKECGVDIFVFETFPELGFIDKAIENAGENGFVITQFAINQFGYSS
AGFSARKLIEEAGKNSYIDACGFNCGVGPGHMKKLVQSLINRNDKYFAVLPNAGYPQVVS
GRMVFDDNNAAYFSQIMHDLAEDGADIIGGCCGTTPEYIRQMVLKTADVVHMKNASIEEE
ISEKKTANDVSFYKGKEGRKLIAVELAPPLGIDDEKIMDAAFLMKESGVDVLTFPDSPSG
RTRADSILMAEKVSRETGMCVMPHICCRDKNAIAMRSQLLGAHINDINNFLVITGDPIPS
VVRASVKSVFNFDSVGLMNIISDMNQEQFAGKPVIYGGAINQGRVNFKVELERVKKKMEA
GATFFMTQPVFSDEDIDRLRQIKEQTGARILCGIMPFVSLRNATFMKNEMTGINVTDEIL
SRYRADMSKEEGEETGIQIAREIIAKTTDFVDGYYFSFPFNRVHMLKKIIGKNNQ
Download sequence
Identical sequences C4Z117
515620.EUBELI_01283 WP_012739515.1.74791 gi|238917210|ref|YP_002930727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]