SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917238|ref|YP_002930755.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917238|ref|YP_002930755.1|
Domain Number 1 Region: 108-393,422-497
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.72e-74
Family Amylase, catalytic domain 0.00058
Further Details:      
 
Domain Number 2 Region: 510-604
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000288
Family alpha-Amylases, C-terminal beta-sheet domain 0.029
Further Details:      
 
Domain Number 3 Region: 6-120
Classification Level Classification E-value
Superfamily E set domains 0.0000042
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917238|ref|YP_002930755.1|
Sequence length 615
Comment glycoside hydrolase family 13 protein [Eubacterium eligens ATCC 27750]
Sequence
MLISKGNPMLMGCSRYKDGYNFTYEAECDSAALLIFDAHMKPKERIELDSSMKCGNIFSV
YVCDRKLDKSFYCYEIDGLMYLDPYAKAITDCGRFGQTDEKDVYLAAIDVADYDWEDDRP
LNYDYSDCIFYKMNVRGFTKSRTSKVKDKGTFSGIINKIPYLKELGITTIELQPAYEFDE
IGRFPQLTDTIMSKYGAGTHYSVDKNTRKINYWGYTGGFYFAPKASYSSIASKHPGVFRD
YTVEFKNVVKELHRNGIEVVMEMFFTDESTGFILQCVRHWVTEYHIDGVHVYCDESALKA
LSQDALLADTKIITVYWNGKTGTKKHMANYNNDFQNIARRLLKGDENMLGEFAAISRKNE
ANSASINYIANNNGFTLNDLVSFDRKHNELNGENNRDGEDFNFSWNCGEEGSTRKRKIKE
LRMRQIKNALAFVFLSAGTPLILAGDEFGNSQNGNNNPYCVDSELSWVNWKETKEGKEIL
EWTKALIQFRQNNKILHMPQSLTLSDRVSCGYPDISYHGTNAWYAQMNTYDRHLGIMYSC
VYGDEEDHSLIYAAYNMHWENHSFALPKINGTWKVDMSSNVSGAVIEDNNRSVCVEPRSV
AILTGTYEIPAKKEK
Download sequence
Identical sequences C4Z145
WP_012739543.1.74791 515620.EUBELI_01311 gi|238917238|ref|YP_002930755.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]