SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917247|ref|YP_002930764.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917247|ref|YP_002930764.1|
Domain Number 1 Region: 274-520
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.99e-70
Family Hsp90 middle domain 0.0000456
Further Details:      
 
Domain Number 2 Region: 4-211
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-56
Family Heat shock protein 90, HSP90, N-terminal domain 0.00011
Further Details:      
 
Domain Number 3 Region: 544-659
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 0.0000000458
Family HSP90 C-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917247|ref|YP_002930764.1|
Sequence length 664
Comment heat shock protein 90 [Eubacterium eligens ATCC 27750]
Sequence
MSKEHGNLSINSQNIFPIIKKWMYSDHDIFYRELVSNACDAITKLKKLSMIGEYEAPDDI
EYKVEIKLSAKDKTIKIIDNGIGMTKEEVDEYINQIAFSGAEAFLEKYKDKANDDQIIGH
FGLGFYSAFMVADQVTIDTLSFKDGAESVHWSCDGGTEYDISEGTKTTPGTEITLYLNED
SYEFANEYKAKEVLDKYCSFMPVPIFVTNEDAGEQTEEIPEEEVTEKDTVLDTFIKDAVT
EEVEKEDGTKETVEKVPAKKMAKIVKRPVAINDIHPLWTKHPNECSDEDYKEFYRKVFHD
YKEPLFWIHLNMDYPFNLKGILYFPKINTEYESIEGTIKLYNNQVFVADNIKEVIPEFLL
LLKGVIDCPDLPLNVSRSALQNDGFVKKISDYITKKVADKLSGMCKTDKENYEKYWDDIN
PFIKFGCLKDEKFAEKMNDYIIFKNLDGKYLTLKECLEENKEKHENTVFYVTDEVEQSQY
INMFKNEGIDAVILTHNIDQPFITNMESKNENLKFKRIDADLSDSFKEETSKDELKDMTE
KLSKTFKDALGKENLTVNVEKLNDSSISSMITLSEESRRMQDMMKMYGMAGMDPNMFGAE
GQTLVLNANNDLVKYVAEHADGENTKIICEQLYDLAMLSHAPLSPEQMTGFIARSNKIME
LLAK
Download sequence
Identical sequences C4Z154
WP_012739552.1.74791 515620.EUBELI_01321 gi|238917247|ref|YP_002930764.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]