SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917250|ref|YP_002930767.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917250|ref|YP_002930767.1|
Domain Number 1 Region: 129-185
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6e-20
Family Cold shock DNA-binding domain-like 0.0006
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.5e-18
Family eIF5a N-terminal domain-like 0.0038
Further Details:      
 
Domain Number 3 Region: 65-129
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-18
Family Cold shock DNA-binding domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917250|ref|YP_002930767.1|
Sequence length 185
Comment elongation factor EF-P [Eubacterium eligens ATCC 27750]
Sequence
MVDAGSFKNGITIQYENGIWQVIEFQHVKPGKGSPFVRAKLKNIISGGVIENSFRPTEKF
DLAHIDRSEYQYLYADGDLYNFMNTETYDQIALSADQVGDSLKFVKENEMVKLCSHEGNV
FAIEPPISVELEVTETEPGIKGNTATGATKPAIVETGAKIMVPLFVNQGDKIKIDTRTGE
YTSRA
Download sequence
Identical sequences C4Z157
gi|238917250|ref|YP_002930767.1| 515620.EUBELI_01324 WP_012739555.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]