SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917267|ref|YP_002930784.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917267|ref|YP_002930784.1|
Domain Number 1 Region: 221-417
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.97e-72
Family B3/B4 domain of PheRS, PheT 0.00000682
Further Details:      
 
Domain Number 2 Region: 39-210
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.18e-41
Family Myf domain 0.0063
Further Details:      
 
Domain Number 3 Region: 485-699
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.71e-39
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00049
Further Details:      
 
Domain Number 4 Region: 710-807
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.09e-26
Family Anticodon-binding domain of PheRS 0.00032
Further Details:      
 
Domain Number 5 Region: 426-493
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000174
Family Domains B1 and B5 of PheRS-beta, PheT 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917267|ref|YP_002930784.1|
Sequence length 808
Comment phenylalanyl-tRNA synthetase [Eubacterium eligens ATCC 27750]
Sequence
MNTSLNWIKAMVPGLECTDQEFRDAMTLSGTKVECFNAFDKNLDKIVVGQILSVERHPDA
DKLVICQVNVGSENVQIVTGAPNIEVGSSGQKVPVVLDGGKVAGGHDGGALPEDGIKIKK
GKLRGVESCGMMCSIEELGSSREFFPDAPEEGIYIFGDDAVVGSSAVEYLGLNDTVFEYE
ITNNRVDCYSVIGIAREAAATFRKPFNPPVVTKTGNDEDVNTMVSVDIEAKELCSRYVAR
VVKNIRLAPSPKWMQQRLMTAGIRPINNIVDITNYVMEEYGQPMHAYDYDTIAGHKIVVR
TATDGEKFVTLDGQERTLDAQTLLICDGEKPVGIAGIMGGENSMITDDVQTMLFEAATFD
GTNIRKTTKKIGLRTDASGKFEKGLDPENAMEAINRACQLIEELDAGDVVGGAVDVYPDP
VTKKRLPFEPAKYNALLGTDVSDEDMLSYFERLEVEYDKDANELIIPTFRQDLNRDADIA
EEVARFFGYDNIPTTLPKGETTMGKISFEQSIEDAASEVAQFTGFSQAMTYSFESPKVFD
KLKLPADSVYRKTVVISNPLGEDFSVMRTLPIHGMLTSLSTNYNRRNKNVKLYELAKVYL
AADDVNELPDERVEFTLGAFGSVDFYSMKGVIEEFLEKIGMKKKPTYDAKAGIPFLHPGR
QADVYYADKKIGYIGELHPDVADTYSIGERTYIVVIDIPTVTEMASFDKKFTGIAKFPAV
TRDISMVMPKELPVGEVEKIIEKRGGKILESYNLFDIYEGSQIKEGFKSVAYSIAFRAKD
RTLEDKDITPVMEKIFKDLEADGIELRK
Download sequence
Identical sequences C4Z1H6
515620.EUBELI_01342 WP_012739572.1.74791 gi|238917267|ref|YP_002930784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]