SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917281|ref|YP_002930798.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917281|ref|YP_002930798.1|
Domain Number 1 Region: 83-233
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-27
Family RecO C-terminal domain-like 0.028
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000223
Family RecO N-terminal domain-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917281|ref|YP_002930798.1|
Sequence length 247
Comment DNA repair protein RecO [Eubacterium eligens ATCC 27750]
Sequence
MAEVTTVTGMILSAMPVGEYDRRLVILTKEYGKITVFAKGARKPNSTLIGVTRSFIFGTF
EVYRGRESYTMYKASAKEYFENVVNDLNAVCYACYFAEIADYYGRENLDASEMINLLYIT
LKALGRGAVSHELIRFIYEIRMVAVNGECPDFFTCHECGREDNLYVYSYSRNGLCCKNCA
TNVYDGITLSGSTVYTLQYIVTAQLNRLYSFTVTKEVQEELRLVVNRLESIVFDKEFKSK
EMLNLTI
Download sequence
Identical sequences C4Z1J0
515620.EUBELI_01356 WP_012739586.1.74791 gi|238917281|ref|YP_002930798.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]