SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917320|ref|YP_002930837.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917320|ref|YP_002930837.1|
Domain Number 1 Region: 144-430
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.2e-123
Family Enolase 0.0000000179
Further Details:      
 
Domain Number 2 Region: 7-140
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.84e-54
Family Enolase N-terminal domain-like 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917320|ref|YP_002930837.1|
Sequence length 435
Comment enolase [Eubacterium eligens ATCC 27750]
Sequence
MAAYLEIEKVIGREILDSRGNPTVEAEVYLADGTVGRGAAPSGASTGEFEALELRDKDKS
RYLGKGVTKAVENINTVINDCLFGIDASDIYAVDAAMIKADGTKDKSNLGANAILAVSIA
AARAASVSLDIPLYRFLGGVSGNRLPVPMMNIINGGCHALSSGLDVQEFMIMPVGAPSFK
ECLRWCAEVFHALAAILKERGLATSVGDEGGFAPALKSDEEAIETILQAVEKAGYKPGRD
FRIAMDAASSEWKSEKGKGYYKLPKAGTEYTAEELIEHWAKLCEKYPIISIEDGLDEEDW
EGWKKLTDRLGDKVQLVGDDLFVTNTERLSKGIELGAGNAILIKLNQIGSVSETLEAIKM
AHKAGYTAISSHRSGETADTTIADLAVALNTCQIKTGAPSRSERVAKYNQLLRIEEQLGA
SAVYPGIRAFNVNND
Download sequence
Identical sequences A0A174YQZ4 C4Z1M9
gi|238917320|ref|YP_002930837.1| 515620.EUBELI_01395 WP_012739625.1.74791 WP_012739625.1.89035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]