SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917338|ref|YP_002930855.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917338|ref|YP_002930855.1|
Domain Number 1 Region: 10-227
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.95e-64
Family G proteins 0.0000909
Further Details:      
 
Domain Number 2 Region: 398-511
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.55e-27
Family Translational machinery components 0.0058
Further Details:      
 
Domain Number 3 Region: 216-314
Classification Level Classification E-value
Superfamily Translation proteins 8.24e-16
Family Elongation factors 0.0058
Further Details:      
 
Domain Number 4 Region: 513-595
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000024
Family EF-G/eEF-2 domains III and V 0.01
Further Details:      
 
Domain Number 5 Region: 323-398
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000119
Family EF-G/eEF-2 domains III and V 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917338|ref|YP_002930855.1|
Sequence length 875
Comment elongation factor EF-G [Eubacterium eligens ATCC 27750]
Sequence
MEKGNDMAHSNPITIGMLAHVDAGKTTLSEAILYSAGSIRKLGRVDNQDTFLDTGDMERA
RGITIFSKQAAYNYNGSSYTLLDTPGHVDFSAETERTLWVLDAAVLVISGMDGVQGHTET
LWSLLKRLGIPVFIFVNKMDQQGTNRARIMEQLKNRLSESCVDFNNIDYEEVAMCHEEAL
EQFLESAHVDDALMSRMIMERKMFPVYFGSALRMNGVEELINGIDTYVSCPDYGEEFSAK
VYKITRDDRGERLTHLKVCGGSLKSKMLIGNEKVNQIRVYAGDKFTSINEAVAGTVCAVT
GLSETKAGQFIGAGGEDNIPVLEPVLNYKLNLPAGTDPVALLSKLRTLEEEEPELHVEWD
ENFKEIHVSVMGPVLIEVLTNIIRTRFGVDVTFGEGSIVYKETIKNKAYGIGHFEPLRHY
AEVHLLLEPGEPGSGMRYECHCSEDILDKNWQRLVYTHLCEKMHRGVLTGSELTDMKITL
VAGRAHPKHTEGGDFRQATYRAVRQGLMQAESVLLEPFYVFSLEVKRDYVGRAMTDFERM
GAAFNMQEADGDNVVITGEGPVSVIGNYQAEVNAYTKGTGRLALKMAGYRPCHNTEEVIE
KFGYEPERDTRNPVDSVFCAGGSGYVVPWNEVREHAHVEIAVTDSGVAGGQSDREVKLTA
KQASRTVSDEWIGTDEVDRILNETYFSNSRGDNERRKLSKRKADTAVGRYVTGGNANVKN
HPKAPEYNPAKKSFLLVDGYNIIHAFKELSELAQVNLDSARGRLLDILCNYQAMKGCELI
AVFDAYRVPGHDEEFIDFHNIHVVFTKTAETADHYIEKFAHENGKKYNVTVATSDGVEQV
IIRGQGCLLISAREFEKEIAAMEEHLRENYLNKTY
Download sequence
Identical sequences C4Z1P7
515620.EUBELI_01415 gi|238917338|ref|YP_002930855.1| WP_012739643.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]