SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917358|ref|YP_002930875.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917358|ref|YP_002930875.1|
Domain Number 1 Region: 2-204
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.21e-28
Family TAP-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917358|ref|YP_002930875.1|
Sequence length 208
Comment arylesterase [Eubacterium eligens ATCC 27750]
Sequence
MKNILFFGDSNTYGYKPDKSGRYDYDVRWTGRIANLLGNEYNIIEEGLCGRTTIFPDAVR
DARKGIDLIGVVVESHKPVDVIAIMLGTNDCKTEFHADAKTIAKGMEAVARKANKTAGEH
AKIVIISPIHLGKGVGEEGFDPEFNESSENVSRQLAWEYEKIAKENGFYYFDAAGAAEPS
EVDRQHLDEKGHKMFAEKYSEFLLTEVL
Download sequence
Identical sequences C4Z1R7
515620.EUBELI_01435 gi|238917358|ref|YP_002930875.1| WP_012739663.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]