SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917368|ref|YP_002930885.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917368|ref|YP_002930885.1|
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily L28p-like 1.73e-26
Family Ribosomal protein L31p 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917368|ref|YP_002930885.1|
Sequence length 68
Comment large subunit ribosomal protein L31 [Eubacterium eligens ATCC 27750]
Sequence
MREGIHPDYYQAKVVCNCGNEFVTGSTKEEIHVEICSKCHPFYTGQQKASSTRGRIDKFN
KKYGVSNN
Download sequence
Identical sequences A0A174Z3I9 C4Z1S7 R5ZQI2
515620.EUBELI_01445 gi|238917368|ref|YP_002930885.1| WP_012739673.1.40640 WP_012739673.1.74791 WP_012739673.1.89035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]