SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917370|ref|YP_002930887.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917370|ref|YP_002930887.1|
Domain Number 1 Region: 180-434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-64
Family RecA protein-like (ATPase-domain) 0.000000117
Further Details:      
 
Domain Number 2 Region: 116-187
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-20
Family Cold shock DNA-binding domain-like 0.00041
Further Details:      
 
Domain Number 3 Region: 10-47
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000145
Family Rho termination factor, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917370|ref|YP_002930887.1|
Sequence length 485
Comment transcription termination factor Rho [Eubacterium eligens ATCC 27750]
Sequence
MNTEVDYMKAKLETLSVSVLREFAKDKNIKNISTMRKSELIEAIIAAAEGEEKNEPAEVA
SVVAEDEADGQNNHKTSEYSHQKSEQYVKEEHKDNYHAQSHKGSEQSKQEQDMPMADGIL
EVLSEGYGFIRCENFLPGENDVYVSPSQIRKFNLKTGDIIQGPKRMKTSGEKFSALMYLE
SVNGKDPSVAQKRPAFESLTPIFPNERIHLEKNSSTVAMRMVDLISPIGKGQRGMIVSQP
KSGKTTLLKQIANAVTKNNPEMHLMILLIDERPEEVTDIKESIVGDNVEVIYSTFDELPE
RHKRVSEMVIERAKRLVEQKTDVIILLDSITRLARAYNLTVQASGRTLSGGLDPAALHMP
KRFFGAARNMREGGSLTILATALVETGSKMDDVVFEEFKGTGNMELVLDRKLSEKRVFPA
IDIAKSSTRREDLLLNKEEQEAVDIMRKALNGLKTDEAAERILDLFVKTKNNEELVRTVI
KNHYI
Download sequence
Identical sequences C4Z1S9
515620.EUBELI_01447 WP_012739675.1.74791 gi|238917370|ref|YP_002930887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]