SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917375|ref|YP_002930892.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917375|ref|YP_002930892.1|
Domain Number 1 Region: 604-780
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.18e-50
Family ATP-dependent protease Lon (La), catalytic domain 0.00000382
Further Details:      
 
Domain Number 2 Region: 310-597
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-50
Family Extended AAA-ATPase domain 0.00094
Further Details:      
 
Domain Number 3 Region: 10-194
Classification Level Classification E-value
Superfamily PUA domain-like 2.49e-26
Family LON domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917375|ref|YP_002930892.1|
Sequence length 784
Comment ATP-dependent Lon protease [Eubacterium eligens ATCC 27750]
Sequence
MSNKYDRHYPAIPLRNVTVFPGMVMHFDVSRKKSVKAVEASMAADELIYLVTQRDSQVSE
PGIADLYTVGTIAKIKQIIKMPGKILRVQVEGLEKALVNRFEEASGMMLADVSVMQGFEK
PDKMVSRAIIVGMRELLTQYAHVNPKFAKDTVKRWLSYNDAEKLMTEFAQEFMMDFDKRQ
QFLEAEDYEQMYTFAATLLVNEINAYTIKEELGNIVRERVDKNQKDYILREELAAINEEL
DGGTITEAEEYEADVEKLDSPQYVKDKLKREIKRLKSLAGNNAEANVERTYIETCLELPW
NVSTEDNKDIDNAAKVLDSDHYGMKDIKERILESLAVRNITGSGKAPVICLAGPPGTGKT
SIARSVAKALGKEYVRICLGGVRDEAEIRGHRKTYIGAMPGRIIEGLKSAGVNNPLMLLD
EIDKISSDYKGDTSAALLEVLDSEQNVNFVDHYIEMPVDLSNVLFIATANDLSNISRPLL
DRMEIIEVGSYTANEKFHIAKEHLIKKQIKENGLLVSDVKFTDKVIRTIINSYTREAGVR
GLERQIAKIVRKAVRELYKAGVFTSDGTRDKTVKKTVNISDKNITDYLGKVKYRPDKKNT
KGEVGIVRGLAWTQAGGDTLEIEVITMPGKGEFKLTGNMGDVMKESASIAVSYIRSVTEK
GRYKVDAEYFQNHAFHLHIPEGATPKDGPSAGITMATAVLSAVTGIPVRADVAMTGELTL
RGKVLPIGGLKEKLLASKTAGITNVFVPRDNRSDVEELDTEITEGMNIIYVNNAIEVFAQ
ALMR
Download sequence
Identical sequences C4Z1T4
WP_012739680.1.74791 gi|238917375|ref|YP_002930892.1| 515620.EUBELI_01452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]