SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917401|ref|YP_002930918.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917401|ref|YP_002930918.1|
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.0000000000000105
Family Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 90-134
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase C-terminal domain 0.000000000314
Family Epsilon subunit of F1F0-ATP synthase C-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917401|ref|YP_002930918.1|
Sequence length 137
Comment F-type H+-transporting ATPase epsilon chain [Eubacterium eligens ATCC 27750]
Sequence
MATSSFYLKVISANRVFFAGKCRSLIVPEFDGQKEILAHHEDMVIAIDEGQMKFQPEGSD
EWIHAVVGMGFVEIVNNRVTLLVETAEKPEEIDVRRAEEAKQRAEERLRQKQSIHEYYHS
RAALARAMARLKATSGK
Download sequence
Identical sequences A0A174Z2U4 C4Z296
515620.EUBELI_01479 WP_012739706.1.74791 WP_012739706.1.89035 gi|238917401|ref|YP_002930918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]