SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917511|ref|YP_002931028.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917511|ref|YP_002931028.1|
Domain Number 1 Region: 9-211
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.15e-35
Family Single strand DNA-binding domain, SSB 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917511|ref|YP_002931028.1|
Sequence length 214
Comment single-stranded DNA-binding protein [Eubacterium eligens ATCC 27750]
Sequence
MLDKVIENNRVCIIGEIVSEFTFSHEVFGEGFYIANVSVNRLSDMVDVIPLMISERLIDV
TKDYRGMKIEVAGQFRSYNRHEGTKNKLVLSIFVRELRFLEDDEMPEEQSKSNQIFLDGY
VCKPPIYRKTPLGREIADILVAVNRPYGKSDYIPCIAWGRNARFAGGLEVGAHLQVSGRV
QSREYTKKIGEEEVERRVAYEVSVSKIDLVEDEE
Download sequence
Identical sequences A0A174ZUJ3 C4Z2K6 R5ZHS6
WP_012739816.1.40640 WP_012739816.1.74791 WP_012739816.1.89035 515620.EUBELI_01590 gi|238917511|ref|YP_002931028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]