SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917530|ref|YP_002931047.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917530|ref|YP_002931047.1|
Domain Number 1 Region: 32-132
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.65e-23
Family Anti-sigma factor antagonist SpoIIaa 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917530|ref|YP_002931047.1|
Sequence length 138
Comment stage II sporulation protein AA (anti-sigma F factor antagonist) [Eubacterium eligens ATCC 27750]
Sequence
MSRQEIKKNYNEAEEKNFDISQEIQEEETRHMDYIYMVNGDKLIIRMNAELDHHLAEEMR
QVIDDVIDKRGVMHIVFDFTKVDFMDSAGIGLIMGRYKKVMDKGDITIVGVRESVKRILL
ISGLHKIVNIYELKGQEV
Download sequence
Identical sequences C4Z2M5
515620.EUBELI_01609 gi|238917530|ref|YP_002931047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]