SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917586|ref|YP_002931103.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917586|ref|YP_002931103.1|
Domain Number 1 Region: 1080-1171
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000262
Family I set domains 0.031
Further Details:      
 
Weak hits

Sequence:  gi|238917586|ref|YP_002931103.1|
Domain Number - Region: 1188-1269
Classification Level Classification E-value
Superfamily E set domains 0.000406
Family Cellulosomal scaffoldin protein CipC, module x2.1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917586|ref|YP_002931103.1|
Sequence length 1336
Comment roundabout, axon guidance receptor 3 [Eubacterium eligens ATCC 27750]
Sequence
MNIIKHKYGKRTVSLLLAVILVLCPLQVRAADNKPTIEADNKPTIEIGDYIQMGTYGGVP
IVWRCVAKDSNGPLMLSDRVLCDYMPYDAKTNKNAETGSHRRNSWRDNFGSNHWRDSNIR
SWLNSNAEAGKVKWLCGNPPTEDSVYPKTAAYDQKEGFLRSFRSDELGAIRTVKQRSIVS
HPEYTAGYIDAAGVDLPYNTTIDTVADGYDSAHYEYIWDRVFLLDVQQLKTVNDNLNGYH
IAKNRSGVAWNYWLRTPITTCNHDMRFVTPQGNILRDAPYKGYYGVRPAFYLNTENYTVS
SGTGQSAQDPYVVSAPDAPDDSIGISGAVREDVNGDWNVNTDEYLQLEMSTLYTEDPAYA
NVTVPVYTIQKPRSDKENMVIVYCAEGYTKSQQKQFVEDVKKLWGEVLQIEPYRSMADRF
NVYALCTASVDGYGGTSTFFAATAKGGISTNKGNWRNHVLERIIGPAFIEKIHDAHIPNE
THPNENTMDHNYRQYDYVYENINQFVVLANSGEYFGGSHDNKQYGIHYIVASARNAYSAF
TQRHELGHGLFHLGDEYNYSTVPVDEWNYTTSLNMTATKDPTKVKWKQLLGFRNTYTCPH
LDYYPYTYNSSRDCLMRETFQNDFCDVCKLQGIKVMSQLITNPPALYVAVPEVKKYIGGY
RNPTKDPSAFEAANSSAYASYQNDRNSRLLSGGSKNSFDYSSMKGQQVELRTIIQNLSNT
QAKTVTLRLWVEHSNGEKAVTTDGEQVFTTQEFDIPVWKEKSKFWTKGALDYEGSDFNSG
LVNCSLVYTIPENAILQSGDTIGFEIVDHATGEVLADDDTEQQRYVNVTIQYQLEDGTDV
PNTMPTTFTVPVGKKVDWQPPQELHGYTFVKAEGMENAVPNSGMTIRYIYKRSEERPEPP
VTKNYTVQYNWGSVFPTGATLPLNSSSYSSVQQAKAAVDKKYTSTTRIQAQKDGKNGTWA
FSGWDAGNLNGTTVVFRGSWSFTADTAPITPPSGTASYKITATAGIGGTISPGGTTTVSA
AGQLTYTIKANEGYYIADVKVDGSEVTATTSYTFSDVNTDHTIEVTFKQESQTPDVPDVI
APSITTQPGNATVKVGETASFTIAASGTDLTYQWQIYRNDGKGWVNIDGATATSYTTSTV
NISCNGFKYKCVVSNSAGNVESNSATLTVQDAGGSDNPDTPNNTYQIIDGANSSWTHDSD
GNITIRGNGDFSKFTGVKVDGNLIDKSNYTAKEGSTIITLKASYLNTLSAGNHTVEILWT
DGSASTTFTTKANISDNSNNNSNSSDDKPSSGTDKKDVTAPKTGDNTPSVWLFILSILSG
TGLIITVKKRRENLNS
Download sequence
Identical sequences C4Z366
WP_012739889.1.74791 gi|238917586|ref|YP_002931103.1| 515620.EUBELI_01665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]