SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917592|ref|YP_002931109.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917592|ref|YP_002931109.1|
Domain Number 1 Region: 191-530
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.64e-121
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000954
Further Details:      
 
Domain Number 2 Region: 10-60,92-184
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.45e-34
Family Anticodon-binding domain 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917592|ref|YP_002931109.1|
Sequence length 534
Comment lysyl-tRNA synthetase, class II [Eubacterium eligens ATCC 27750]
Sequence
MGDNKSAQQPDVNEQIKVRMEKLKNLQDAGKDPFQITKYDVTHHTDEIRAIYEAHEKELL
GDRPAVNTEGLDEQQAREAVNADYNERRAIMDASPINVSFAGRMMFKRVMGKASFCNIAD
LKGRMQAYISRDAIGEEAYADFKKSDIGDIFGIKGFIFRTKTGEISVHAEEITLLSKSLQ
VLPEKFHGITDTDMRYRQRYVDLIMNPEVKETFVKRSKIIKEIRKFLDGRDFMEVETPTL
VSNAGGAAARPFETHYNALDEDVKLRISLELYLKRLIVGGLERVYEIGRVYRNEGVDTRH
NPEFTLMELYQAYTDYEGMMELTESMFRHLAETVCGTTKITYNGTEIDLGKPFRRLTMND
AIKEYAGVDFDTIKTDEEAKALAKERGIEFEERHTKGDIINLFFEEYCEENLIQPTFIMD
HPLAISPLTKKKPSDPEKVERFELFINTWEMCNAYSELNDPIDQRERFAQQDKNAENGDE
EAQHTDEDFLNALAVGMPPTGGIGYGIDRLVMLLTDSPAIRDVLLFPTMKSIDK
Download sequence
Identical sequences C4Z372
WP_012739895.1.74791 515620.EUBELI_01671 gi|238917592|ref|YP_002931109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]