SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917593|ref|YP_002931110.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917593|ref|YP_002931110.1|
Domain Number 1 Region: 4-77
Classification Level Classification E-value
Superfamily GreA transcript cleavage protein, N-terminal domain 3.66e-22
Family GreA transcript cleavage protein, N-terminal domain 0.00059
Further Details:      
 
Domain Number 2 Region: 82-156
Classification Level Classification E-value
Superfamily FKBP-like 4.97e-20
Family GreA transcript cleavage factor, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917593|ref|YP_002931110.1|
Sequence length 158
Comment transcription elongation factor GreA [Eubacterium eligens ATCC 27750]
Sequence
MAEKQFLTKKGYDERVARLEELKVVRRKEVAQKLKEAREQGDLSENAEYDAAKDEQRDIE
TEIAELEAILANCEVIQDNDKNKDVVKMESVVVLHDVEIDEDIEYTIVGSSEADSLNNKI
SNESPLGAALIGKKKGDTVKVEAPVGEIEYTVVSVKND
Download sequence
Identical sequences C4Z373
gi|238917593|ref|YP_002931110.1| 515620.EUBELI_01672 WP_012739896.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]