SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917634|ref|YP_002931151.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917634|ref|YP_002931151.1|
Domain Number 1 Region: 30-172
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.0000000000000366
Family Regulatory protein AraC 0.012
Further Details:      
 
Domain Number 2 Region: 243-291
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000582
Family AraC type transcriptional activator 0.015
Further Details:      
 
Domain Number 3 Region: 191-241
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000112
Family AraC type transcriptional activator 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917634|ref|YP_002931151.1|
Sequence length 291
Comment AraC family transcriptional regulator [Eubacterium eligens ATCC 27750]
Sequence
MNITDYGPLKETKSHFDSDFLYNTYPCSIPLDFTEVPLHWHNEMELIYIKKGCMIVSVDL
EYSVVNAGDIVVVMPGHIHSIIQNESDSCEYENILFNLDMLVSRQCDYDTVSFFNGIAGF
NGYCPPVISKTAPHYSDLIHYIDEADNICKYFPDGYRLKIRACLFNFFFELNAHFYTHTD
MPVHLSDDKMDKLKLVLNYIEKNFARAISIEEIAQWCHFSQSHFMKFFKNCTGTSFITYL
NDYRLIIAARILKTTTQPVIIVASDCGFDNISYFNRKFKEKYGVSPREFRK
Download sequence
Identical sequences C4Z3B4
515620.EUBELI_01713 gi|238917634|ref|YP_002931151.1| WP_012739937.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]