SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917653|ref|YP_002931170.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917653|ref|YP_002931170.1|
Domain Number 1 Region: 82-238
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0000999
Family BT2961-like 0.064
Further Details:      
 
Weak hits

Sequence:  gi|238917653|ref|YP_002931170.1|
Domain Number - Region: 282-421
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.00394
Family TAP-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917653|ref|YP_002931170.1|
Sequence length 437
Comment hypothetical protein EUBELI_01732 [Eubacterium eligens ATCC 27750]
Sequence
MKLKKFAIVGAVALALMGTVTSFVLAHGNSIVKNDNSSYVEIEIPKGDRTHDIVSVSDSI
SGDDSILDSDGRDTTADYKSDRGIACWGDSMTEGLGTDEGYILTGVGRVDISYYTSPHTI
ERLTGIRTYNFGVSGEKSDEISIRAGGLGLYTDRNVYITPYEYTDVVLVGDDGQPVHMYD
YSGYGIEYNDYPDTVYINGILCQIENRYEDRVAKQEAEREAAEEEGEDWFDILQDFGDEL
IPGDYDNLKQEDYVVGIKLYDIENEQHRDGMYVAQGSRVVPKAAQDHRDDILIIEMGSNG
GWDNYDELIAQYQSIIDYTGCEDYIIVGDTDDPGSSLADEGVINMDNSEGGTGKNYTDWE
VALRDAFGEHFFNTRVYMLEYGLSNCGLKASALDRLYAAFGCISGKLRSDWTHFNAYGYY
AKGLGLYQKGVELGYWE
Download sequence
Identical sequences C4Z3D3
515620.EUBELI_01732 gi|238917653|ref|YP_002931170.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]