SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917767|ref|YP_002931284.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917767|ref|YP_002931284.1|
Domain Number 1 Region: 733-1016
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.08e-85
Family beta-Galactosidase, domain 5 0.00023
Further Details:      
 
Domain Number 2 Region: 312-613
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.56e-82
Family beta-glycanases 0.00000074
Further Details:      
 
Domain Number 3 Region: 12-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.84e-61
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000118
Further Details:      
 
Domain Number 4 Region: 222-311
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000000000647
Family beta-Galactosidase/glucuronidase domain 0.0038
Further Details:      
 
Domain Number 5 Region: 619-714
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000151
Family beta-Galactosidase/glucuronidase domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917767|ref|YP_002931284.1|
Sequence length 1020
Comment glycoside hydrolase family 2 protein [Eubacterium eligens ATCC 27750]
Sequence
MNEGGVFMIVPRYYEDLSVLHDNTMLARAYYMPASKRMDDLVEHRELSDRMQLLNGTWKF
QYFDSIYDMKDAFYEDGYSVESFDEIAVPSVWQMAGYDTHQYTNIRYPFPFDPPYVPQDI
PCGAYVHTFDYARDDAAPKAYLNFEGVDSCFYVWLNGTYVGYSQVSHMTSEFDVTDVLRE
GENRISVLVMKWCDGSYLEDQDKFRMSGIFRDVYLLKRPEKAIRDYHITTELDADIAKID
LTVSFHEPVEVRVKIEDKNGAVVSEGVIDKNGKATFEIVDYKLWNTENPYLYTIIFETEQ
EVIVDHIALRKIEIKDQVIYLNGQKIKFRGVNRHDSDPVTGFTISMEQIKIDLTLMKQHN
FNAIRSSHYPNAPFFYEMCDRYGFMVIDEADIEAHGPFMLYRKEDTDYNRFKRWNEKIAD
DPAWEAAIVDRVKLMVERDKNRFCIVMWSMGNESAYGCNFEKALAWTKEFDPERITQYES
ARYRNYDVTYDYENLDLYSRMYPALTEIEEYLEKDGSKPFLLVEYCHSMGNGPGDFEDYF
QMIQAEDKMCGGFVWEWCDHAIVHGVAENGKTIYAYGGDHGEVIHDSNFCMDGLVYPDRR
IHTGLLEYKNVYRPARVVSYDAASGELVLHNYMDFDDLKDYAEITYELSQDGLVIGKGKL
SEVSILPHCDGSTTLKLSIPENGKVYLKLFYKLKKDIPLLSKAYVLGFDEIDVSSKGAKN
QQALSWLTKEVPDTRIQVQENDTEINIKGREFSYIINKRTALFDSLIFAGREYLKNPMEL
NIWRAPTDNDMYIKAEWRKAHYNEAYTRAYNSEVIQGKHGVTVVSQASVVAPTVQKILDV
TLIWTIDAAGRIGADIAVKKNDEFPDLPRFGVRMFLDKKLTDAGFFGMGPQESYRDKHRA
ASHGLYRLKVSDMHEDYIRPQENGSHYDCDYVELGNSQYGITAIAEEDAFSFNASFYTQE
ELEKKAHNYELIESDSTVLCLDYAQNGIGSNSCGPDVLDAYRFDDRLFRFRFTLVPYVKG
Download sequence
Identical sequences C4Z412
515620.EUBELI_01848 gi|238917767|ref|YP_002931284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]