SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917768|ref|YP_002931285.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917768|ref|YP_002931285.1|
Domain Number 1 Region: 5-155
Classification Level Classification E-value
Superfamily Regulatory protein AraC 1.07e-19
Family Regulatory protein AraC 0.013
Further Details:      
 
Domain Number 2 Region: 222-271
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000022
Family AraC type transcriptional activator 0.023
Further Details:      
 
Domain Number 3 Region: 172-219
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000264
Family AraC type transcriptional activator 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917768|ref|YP_002931285.1|
Sequence length 276
Comment AraC family transcriptional regulator [Eubacterium eligens ATCC 27750]
Sequence
MDFKDKSRPLIVGSCGIYRLSEHPKIPTYRPRGRVDFQIIYIAAGCGHFHFDTVDNETIV
PAGNIVIFRPKELQKYEYYGEDKTEVYWIHFTGSDVKNILRKYGFPDNERIFPVGTSMEY
ERVFKRIIIELQRCQDNYEEMLTLLLRHLLIIFQRELTREHVLKNEYLNHEMDTAVTYFN
ENYNRDINIEEYATSKGMSVSWFIRNFKKFTGSTPMQFIVALRVNNAQVLLEATNYSINE
ISKIVGYDNQLYFSRLFHKLKGDSPRDYRKTRKSEI
Download sequence
Identical sequences C4Z413
gi|238917768|ref|YP_002931285.1| 515620.EUBELI_01849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]