SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917769|ref|YP_002931286.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917769|ref|YP_002931286.1|
Domain Number 1 Region: 67-220,252-376,407-482
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.69e-80
Family (Uracil-5-)-methyltransferase 0.00043
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000434
Family TRAM domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917769|ref|YP_002931286.1|
Sequence length 484
Comment hypothetical protein EUBELI_01850 [Eubacterium eligens ATCC 27750]
Sequence
MSFKKDDKVTFVIEDIGTGGEGIGKVDGYTLFVKDAIIGDKIEAKIIKAKKNYGYARLEK
IIEASSDRVTPACLVARQCGGCQIQQMSYQAQLRFKEKLVDDNLKRIGKIEGYEFFPAIG
MEEPFRYRNKAQYPVGTAKDGSVVMGFYAGRTHSIISCTDCKIGAVENQYILAVIKSWME
LNGVAPYDEQTRKGLVRHVLIRTGFHTDEIMVCLVINGTKMSDKLKESLVGRLTEVSLDS
DISTDKCIKSIMLNYNTENTNVILGRQCETLWGKSYIEDYIGDIKYQISPLSFFQVNPRQ
TEKLYGKALEYAGLTGNETVWDLYCGIGTISLFLAKNARKVYGVEIVPQAIEDAKNNAAI
NGIDNAEFFVGKAEEVVPHFYEEMARLATDTSATEAQREEARKSITPDVVVVDPPRKGCD
ESLLDTIVKMSPERIVYVSCDSATLARDLGLLAAKGYKTVKVQPVDQFSHTVHVECVCLL
VRME
Download sequence
Identical sequences C4Z414
WP_012740071.1.74791 gi|238917769|ref|YP_002931286.1| 515620.EUBELI_01850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]