SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917770|ref|YP_002931287.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917770|ref|YP_002931287.1|
Domain Number 1 Region: 149-279
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.28e-17
Family HD domain 0.025
Further Details:      
 
Weak hits

Sequence:  gi|238917770|ref|YP_002931287.1|
Domain Number - Region: 26-94
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00141
Family Single strand DNA-binding domain, SSB 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917770|ref|YP_002931287.1|
Sequence length 314
Comment CMP-binding protein [Eubacterium eligens ATCC 27750]
Sequence
MRYIETLKDGERISEVYLCKSKSIALTKTGKEYANVMLADKTGQIDSKIWDLNSGGIAEF
DVNDYVAVTGQVTSYNGALQFKIERARIASENEYVAADYVPSSRYNIDNMFAELMKYVDS
VKSTYMKQLLYSFFKDEAFAKKFKCVSAAKTVHHGFAGGLLEHSLSVTRLCDKMSSNYDF
LNRDLLITCAMLHDVGKVKELSEFPKNDYTDEGNFLGHIVIGYEMVMEKVKQIDGFPDML
AMQIGHCILSHHGELEYGSPKKPSIAEAVALSMADNMDAKLETLREALEAKDTNDWLGYN
RWLDSNIRRTTNEF
Download sequence
Identical sequences A0A174ZGX0 C4Z415
515620.EUBELI_01851 gi|238917770|ref|YP_002931287.1| WP_012740072.1.40640 WP_012740072.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]