SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917786|ref|YP_002931303.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917786|ref|YP_002931303.1|
Domain Number 1 Region: 136-245,281-609
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.67e-76
Family Amylase, catalytic domain 0.00000049
Further Details:      
 
Domain Number 2 Region: 30-144
Classification Level Classification E-value
Superfamily E set domains 1.18e-22
Family E-set domains of sugar-utilizing enzymes 0.0089
Further Details:      
 
Domain Number 3 Region: 621-699
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000309
Family alpha-Amylases, C-terminal beta-sheet domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917786|ref|YP_002931303.1|
Sequence length 704
Comment glycoside hydrolase family 13 protein [Eubacterium eligens ATCC 27750]
Sequence
MRITGEMGNLAAWEKRLFYMCSARPTLHPRALFSDVTSDYRNPAEPEPGDEVTIRLRTGR
YNVDKAYLVVDNVERVMTRVRSESLFDYYEAKINVGTDKIYYYFKVELGRTVCYYNQIGA
IKELNPYYNFQITPGFKTPAWAKGAVMYQIFVDRFCNGDKSNDVLDDEYNYIGEHVCQVK
DWNKYPAQMGIREFYGGDLKGVLDKLDYLQELGVEVIYFNPLFVSPSNHKYDIQDYDYID
PHFGVIVDDEGEVLREGDTDNTHATRYISRVTRKSNLEASNDFFAKVVQEIHSRGMKVII
DGVFNHCGSFNKWLDKEHIYRDSADEYAPGAYERYESPYHNFFKFYSNQWPDNNSYDGWW
GHDTLPKLNYEGSKELEEYILSIGRKWVSAPYNVDGWRLDVAADLGYSPEYNHYFWKRFR
EEVKKANPDAIILAEHYGDSYEWLQGDEWDTIMNYDAFMEPVTWFLTGMEKHSDEARPDS
YGNPDYFFGAMHHNMARMGGQSVAISMNELSNHDHSRFLTRTNRTVGRTNTLGPEAANNN
VNKAVFKEAVVMQMTLPGAPTVYYGDEAGVCGFTDPDNRRTYPWGHEDTELIDFHRTAIK
MHKENDVLRKGSYKSLYSAYNVVAYGRFTSDDAAIIIVNNNDDEVRARIPAWEVGLGFDD
DVEQLLVTFEGGYSTDRLGYHLQNGWLDIGLRKTSAVVLHKMKW
Download sequence
Identical sequences C4Z431
515620.EUBELI_01867 gi|238917786|ref|YP_002931303.1| WP_012740088.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]