SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917802|ref|YP_002931319.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917802|ref|YP_002931319.1|
Domain Number 1 Region: 12-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.1e-85
Family ABC transporter ATPase domain-like 0.00000203
Further Details:      
 
Domain Number 2 Region: 259-336
Classification Level Classification E-value
Superfamily MOP-like 0.0000000334
Family ABC-transporter additional domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917802|ref|YP_002931319.1|
Sequence length 362
Comment sulfate-transporting ATPase [Eubacterium eligens ATCC 27750]
Sequence
MAELQQDTEKYVELRNINKTYGTFKASNNINLGIGKGKLIALLGPSGSGKTTILRMIAGL
ETADSGDIIIDGKVVNDVPASKRGIGFVFQNYALFRYMTVYDNIAFGLKVNKWKKSDIKK
RVDELIELVGLSGMAKRYPSQLSGGQRQRVAFARALAPNPELLLLDEPFAAIDAKVRQEL
RSWLRDMITKVGITSIFVTHDQDEAIEVADEIIVTNKGHIEQIGTPRQIYREPETAFMAE
FMGHPVHVDRINKIKGFNQLDDSVKAVLRPENVNITRLDEKVDSAASVEKGVVVGKLFMG
KEVEITVNVNGIEVVGTRNVEEAPIKKGEEVNVFIHRAFTYGADGIVNIVENANKFEDWM
VI
Download sequence
Identical sequences C4Z447
WP_012740104.1.74791 gi|238917802|ref|YP_002931319.1| 515620.EUBELI_01883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]