SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917836|ref|YP_002931353.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917836|ref|YP_002931353.1|
Domain Number 1 Region: 3-258,319-335
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.13e-66
Family glucose-1-phosphate thymidylyltransferase 0.0000518
Further Details:      
 
Domain Number 2 Region: 279-353
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.0000000000000295
Family GlmU C-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917836|ref|YP_002931353.1|
Sequence length 371
Comment glucose-1-phosphate adenylyltransferase [Eubacterium eligens ATCC 27750]
Sequence
MKAIGIILAGGNNRMMRELSNKRAIAAMPIAGSYRAIDFALSNMTNSRIQKVAVITQYNA
RSLNEHLSSSKWWDFGRKQGGLFVFTPTITAESSNWYRGTADSLYQNMQFLKQSHEPYVV
IASGDGIYKLDYNKVLQYHIEKKADITVVVKNLEDRSEIGRYGVVAMTEEGRITDIDEKP
LETNLSTVSTGIYVIRRRLLIELLEKAAEEDRHEFVRDILVRYKNVKKIYGYKLDTYWSN
ISTVDSYYKTNMDFLKKDVRDYFFKQYPDVYSKVEDLPPAKYNFGANVRNSLVSSGCIVN
GTVEDSVLFKKIYIGNNSVIKNSIILNNAYIGDNAYIENCIVESNSTIKANSRYVGENGV
RIVVEDSPLYY
Download sequence
Identical sequences C4Z4L7
515620.EUBELI_01917 gi|238917836|ref|YP_002931353.1| WP_012740138.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]