SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917837|ref|YP_002931354.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917837|ref|YP_002931354.1|
Domain Number 1 Region: 2-261,305-322
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.65e-86
Family glucose-1-phosphate thymidylyltransferase 0.000022
Further Details:      
 
Domain Number 2 Region: 225-403
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 1.19e-34
Family UDP N-acetylglucosamine acyltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917837|ref|YP_002931354.1|
Sequence length 423
Comment glucose-1-phosphate adenylyltransferase [Eubacterium eligens ATCC 27750]
Sequence
MIKKEMIAMLLAGGQGSRLGVLTSKVAKPAVAFGGKYRIIDFPLSNCINSGIDTVGVLTQ
YQPLRLNTHIGIGIPWDLDRNVGGVSVLPPYEKSQNSEWYTGTANAIYQNLEYMEQYHPE
YVLILSGDHIYKMDYKIMLDYHKANNADITIAAMPVPMEEASRFGVVVTDNDNKITEFEE
KPEHPKSNLASMGIYIFSWKVLKDALIKLKDQQECDFGKHVIPYCFNNNKRIFAYEYNGY
WKDVGTLSSYWEANMELIDIIPIFNLYEEFWKIYTKTDTIPPQYIAKDAYIEKSIIGDGT
EVYGRVFNSVIGSGVVIEEGCVIRDSIIMNNSHIGKNTTITKSIIAEDVTIGENVELGVG
EEAENVKFPKIYNSGLVTVGEWSVIPDNVKVGKNTAISGETTLQDYPNGELPGGGIIIKA
GDN
Download sequence
Identical sequences C4Z4L8
WP_012740139.1.74791 515620.EUBELI_01918 gi|238917837|ref|YP_002931354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]