SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917846|ref|YP_002931363.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917846|ref|YP_002931363.1|
Domain Number 1 Region: 6-87
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase N-terminal domain 1.27e-19
Family Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 89-133
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase C-terminal domain 0.0000000144
Family Epsilon subunit of F1F0-ATP synthase C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917846|ref|YP_002931363.1|
Sequence length 134
Comment F-type H+-transporting ATPase epsilon chain [Eubacterium eligens ATCC 27750]
Sequence
MADLQTIKLLVNTPDRVFYHDDATFVELSTSEGDIGVYPGHIPLTAVVVPCVLSIHNGND
VKKAAVHGGIIEILKDKITILAEVAEWSDEIDVERANEARLRAEKRLASHDSNLDMVRAE
TALKRSLARIKAVN
Download sequence
Identical sequences C4Z4M7
gi|238917846|ref|YP_002931363.1| WP_012740148.1.74791 515620.EUBELI_01927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]