SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917870|ref|YP_002931387.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917870|ref|YP_002931387.1|
Domain Number 1 Region: 56-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 2.88e-25
Family Ribosomal protein L9 C-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.66e-16
Family Ribosomal protein L9 N-domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917870|ref|YP_002931387.1|
Sequence length 148
Comment 50S ribosomal protein L9 [Eubacterium eligens ATCC 27750]
Sequence
MDVILLEDVKTLGKKGQIVKINDGYARNYVLPKKLGIEATAKNLNDLKLARKREEKEAAE
ELAAAKELAAKIKECTVTVSMKTGEGGRTFGTVSTKEVAEEAKKQLGLDIDKKKMKLDVP
IKALGNYIIQIKLHKDVTAELTVKVVEK
Download sequence
Identical sequences A0A174YZB2 C4Z4Q1 R5ZN86
515620.EUBELI_01951 gi|238917870|ref|YP_002931387.1| WP_012740172.1.40640 WP_012740172.1.74791 WP_012740172.1.89035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]