SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917929|ref|YP_002931446.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917929|ref|YP_002931446.1|
Domain Number 1 Region: 4-198
Classification Level Classification E-value
Superfamily Recombination protein RecR 1.57e-74
Family Recombination protein RecR 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917929|ref|YP_002931446.1|
Sequence length 198
Comment recombination protein RecR [Eubacterium eligens ATCC 27750]
Sequence
MDIYSGHINRLIEELSRLPGVGAKSAQRLAFHIINMPESEVKSLADTMIDAKQHIHYCKE
CFTLTDEELCPICRDQKRDHKTIMVVEHTRDMAAYEKTGKYEGVYHVLHGAISPMLGIGP
ADIRLKELMVRLQGDVDEVIIATNSNLEGETTAMYISKMIKPTGIKVTRIASGVPVGGDL
EYIDEVTLLRALDGRTEL
Download sequence
Identical sequences A0A174ZXD2 C4Z4W0 R5ZWJ3
WP_012740231.1.40640 WP_012740231.1.74791 WP_012740231.1.89035 gi|238917929|ref|YP_002931446.1| 515620.EUBELI_02016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]