SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917941|ref|YP_002931458.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917941|ref|YP_002931458.1|
Domain Number 1 Region: 5-352
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.18e-111
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000591
Further Details:      
 
Domain Number 2 Region: 354-518
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 4.49e-34
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00078
Further Details:      
 
Domain Number 3 Region: 552-656
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.79e-27
Family Myf domain 0.0000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238917941|ref|YP_002931458.1|
Sequence length 657
Comment methionyl-tRNA synthetase [Eubacterium eligens ATCC 27750]
Sequence
MPQSKGPFYMTTAIAYTSGKPHIGNTYEIVLADSIARFRRQEGYDVFFQTGTDEHGQKIE
LKAEEAGITPKEFVDNVSTEIKRIWDLMNTSYDKFIRTTDDYHEKQVQKIFKKLYDQGDI
YKGSYEGMYCTPCESFWTESQLVDGKCPDCGREVKPAKEEAYFFKMSKYANKLIEHINTH
PEFIQPVSRKNEMMNNFLLPGLQDLCVSRTSFKWGIPVDFDDKHVVYVWLDALTNYITGI
GYDADGNSSEQYKKFWPADLHLIGKDIIRFHTIYWPIFLMALGEPLPKQVFGHPWLLQND
GKMSKSKGNVIYADDLVDLFGVDAVRYFVLHEMPFENDGVISWELMVERMNSDLANTLGN
LVNRTIAMSNKYFGGVVNKTGVEDAAIDGDLKAVVTATRDKVQAKMATLHVADAITEVFT
LFKRCNKYIDETMPWALAKDEAQQDRLAEVLYNLVESITIGANLLKSFMPETTDKILAQL
YPANPEAGVRDFDDLATFGLRETGLKVTETPEILFARLDFEKDLKEKVDAIQEAQKKANG
VTEYPQVEVKPEITFDDFEKVQFRVAKVLTCEAVKKTKLLKFELQIGDEKRTIVSGIQKY
YKPEELIGKKLVVCTNLKPRKICGIESQGMIISAWDDKDNLSVLTLEKDIIEGAEIG
Download sequence
Identical sequences C4Z5A4
WP_012740243.1.74791 gi|238917941|ref|YP_002931458.1| 515620.EUBELI_02029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]