SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917956|ref|YP_002931473.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917956|ref|YP_002931473.1|
Domain Number 1 Region: 91-532
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.3e-112
Family Amylase, catalytic domain 0.00000000696
Further Details:      
 
Domain Number 2 Region: 540-635
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.34e-17
Family alpha-Amylases, C-terminal beta-sheet domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238917956|ref|YP_002931473.1|
Sequence length 647
Comment glycoside hydrolase family 13 protein [Eubacterium eligens ATCC 27750]
Sequence
MEDFMKNMQKYEQLAITELDAYLFGQGTHYEIYNKMGAHVGVKDGKEGVYFAVWAPAARE
VYVIGEFNNWNAYGYDMKKISDGGIYDLFIPGAKAGDMYKYLIISQSGEALYKADPYANQ
AQLRPETASIVADLSGYEWKDSEWVEKKKTENHLKAPLSIYECHLGSWKKKDDGTEDGFY
TYRELAPELAKYVSDMGYTHIELMGIAEYPYDGSWGYQVTGYYAPTARYGTPKDFMYFVD
YMHEKGIGVILDWVPAHFPKDAHGLANFDGSCVYEYADPRKGEHPDWGTKVFDYSKNEVS
NFLIANGMFWVDKFHIDGLRVDAVASMLYLDYGRTEGNWVPNKYGDNGNLEAISFLKHFN
SMLKKRFPQAITIAEESTAWPMVSGDPDNGECLGFTFKWNMGWMHDFLEYMKLDPYFRKF
NHSKMTFSLMYAYSENFILVLSHDEVVHLKCSMLGKMPGDREDKFKNLKLAYAYMCGHPG
KKLLFMGQEFGQWNEWSEKRALDWYLLEDESHTELKDFTKKCLKLNKNYPCLYATDYSSE
GFRWINANDKDNSVLSFMRISPDGKKNLLFVLNFTPVERDSFRIGVPFKTKYKLVLGDNE
ADQKKTLTAVKGDCDGYPQSLLIDLHKYGIAVYEFNGDVSKVHATKI
Download sequence
Identical sequences C4Z5B9
WP_012740258.1.74791 gi|238917956|ref|YP_002931473.1| 515620.EUBELI_02045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]