SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238917979|ref|YP_002931496.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238917979|ref|YP_002931496.1|
Domain Number 1 Region: 9-119
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.24e-26
Family RNase P protein 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238917979|ref|YP_002931496.1|
Sequence length 121
Comment ribonuclease P protein component [Eubacterium eligens ATCC 27750]
Sequence
MRMVNDMKYKDFETLRSNQEFKKVYNNKKSFANKNLIMYISENGTDTKRLGVSVSKKVGN
SIVRHRLARLIREAFRLSTDCIPDGYDYVVVARASLKDKGFFETKESMIHLLKLHKLYKQ
D
Download sequence
Identical sequences C4Z5E2
515620.EUBELI_02069 gi|238917979|ref|YP_002931496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]