SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238921791|ref|YP_002935305.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238921791|ref|YP_002935305.1|
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily Rubredoxin-like 2.19e-20
Family Rubredoxin 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238921791|ref|YP_002935305.1|
Sequence length 51
Comment rubredoxin-NAD+ reductase [Eubacterium eligens ATCC 27750]
Sequence
MKYVCDVCGWEYDEEKGYPEGGIAPGTKWEDIPEDFECPLCSVGKDQFSEA
Download sequence
Identical sequences A0A175ACE0 A0A1C6JYJ8 A0A1Q9J0X0 C4Z793
515620.EUBELI_20024 WP_012740305.1.3382 WP_012740305.1.40640 WP_012740305.1.74791 WP_012740305.1.89035 gi|238921791|ref|YP_002935305.1| gi|238921791|ref|YP_002935305.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]