SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238921792|ref|YP_002935306.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238921792|ref|YP_002935306.1|
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily Superoxide reductase-like 1.83e-24
Family Superoxide reductase-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238921792|ref|YP_002935306.1|
Sequence length 77
Comment superoxide dismutase, partial [Eubacterium eligens ATCC 27750]
Sequence
MEVYTVEGSHVHVVVGETKHPMLEEHFIEWITLNTNQGIYRKQLNPGQEPVADFCLCDGE
QVEEVYAYCNLHGLWKC
Download sequence
Identical sequences A0A174Z208 C4Z794
515620.EUBELI_20025 WP_012740306.1.40640 WP_012740306.1.74791 WP_012740306.1.89035 gi|238921792|ref|YP_002935306.1| gi|238921792|ref|YP_002935306.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]