SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238921880|ref|YP_002935394.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238921880|ref|YP_002935394.1|
Domain Number 1 Region: 92-194
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.53e-32
Family Riboflavin synthase 0.00016
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.98e-25
Family Riboflavin synthase 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238921880|ref|YP_002935394.1|
Sequence length 214
Comment riboflavin synthase alpha chain [Eubacterium eligens ATCC 27750]
Sequence
MFTGIIEEIGHVNNVKKGTASAILTIQAEKVLKGTHIGDSIAVNGVCLTVTGIYDNTFTA
DVMHETLNRSSLGKLVSGSAVNLERAMAADGRFGGHIVSGHIDGTGKVAAITRDDNAIWY
QIKTDIGILKYIVEKGSVAIDGISLTVAKTDSQSFSVSIIPHTAGATTLSLRKAGDVVNL
ENDIVGKYIEKFITFEKEKPKSGITKEFLLKNGF
Download sequence
Identical sequences C4Z7I2
gi|238921880|ref|YP_002935394.1| gi|238921880|ref|YP_002935394.1|NC_012780 WP_012740394.1.74791 515620.EUBELI_20113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]