SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238921928|ref|YP_002935442.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238921928|ref|YP_002935442.1|
Domain Number 1 Region: 239-288
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000022
Family AraC type transcriptional activator 0.019
Further Details:      
 
Domain Number 2 Region: 26-135
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.0000000000000458
Family Regulatory protein AraC 0.011
Further Details:      
 
Domain Number 3 Region: 191-236
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000986
Family AraC type transcriptional activator 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238921928|ref|YP_002935442.1|
Sequence length 292
Comment two-component system, response regulator YesN [Eubacterium eligens ATCC 27750]
Sequence
MYFELKENRPHGTPENPFSQYHISDVKRAFQIPVHWHDELEIIYVKQGKLHVTISGENYI
GSPKDTFVVSPGSLHFMGSPTGDADYYTFLFPLEYISFQTDDLMEKSILSPLKRGRLMIS
PQINDTAADICERLIEINAQISGKNAENTDAANIEAQFETKITLIKFIQKMWSNNLILEN
GTNGTNTIEKEMITYIRQNYTREISLKEFGAQFHLSEKYISRYFKEHFHITLSQYINHLR
LEHARQLLEESATSVTEVAMCSGYQNVSYFIRSFKKMYGVSPLKYRKASCII
Download sequence
Identical sequences A0A174YHX5 C4Z7N0
515620.EUBELI_20162 APC21130 WP_012740440.1.74791 WP_012740440.1.89035 gi|238921928|ref|YP_002935442.1| gi|238921928|ref|YP_002935442.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]