SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238921995|ref|YP_002935509.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238921995|ref|YP_002935509.1|
Domain Number 1 Region: 234-286
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000112
Family AraC type transcriptional activator 0.01
Further Details:      
 
Domain Number 2 Region: 29-152
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.0000000000183
Family Regulatory protein AraC 0.025
Further Details:      
 
Domain Number 3 Region: 187-231
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000762
Family AraC type transcriptional activator 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238921995|ref|YP_002935509.1|
Sequence length 304
Comment LacI family transcriptional regulator [Eubacterium eligens ATCC 27750]
Sequence
MADNKITFFGKCDGISVEQLIRYSRFNMNVKHFHNQYEIFYIIEGERQFFFDNKSYNAYA
GDIAILDTNLVHTTCSISDEDKGYNRVILYIDYEKMCDFDKKYPGLNLVNYFHNNYGIYH
LNEDQRIAFLNLYRDLRHELTKKNSGYQSRVEIATIYWLYKLLSLKHDSTQIHAVINSPK
ELSASNISAYLEANYTKELALDTISDELFMSKYYMCRIFKEYTGFTITEYVNTLRIKKAT
QILESSNLSISDVAAELGFESASYFERIFKKIMTVTPLKYRKTHQSVTIEHEELNTLDDS
DYLD
Download sequence
Identical sequences A0A174YQ81 C4Z7U7 R6AJJ3
gi|238921995|ref|YP_002935509.1|NC_012780 WP_012740507.1.74791 WP_012740507.1.89035 515620.EUBELI_20230 gi|238921995|ref|YP_002935509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]