SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922055|ref|YP_002935569.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922055|ref|YP_002935569.1|
Domain Number 1 Region: 23-310
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.03e-76
Family EF1021-like 0.000000304
Further Details:      
 
Domain Number 2 Region: 311-417
Classification Level Classification E-value
Superfamily SCP-like 2.67e-26
Family EF1021 C-terminal domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238922055|ref|YP_002935569.1|
Sequence length 417
Comment hypothetical protein EUBELI_20290 [Eubacterium eligens ATCC 27750]
Sequence
MYEISAHRKGTNAMSRNDENNYTLRPLTIDDAEEYNALLRYAFQVTEQELAETGWKDDEI
TQSKFPVLQRADVLGCFNGDDLIAQFAVYPLDMNIYGMKYSVGFVTSVCTYPEYTGHGIM
KRLMIQSLIRMRDAHKSFALLYPYSIPLYRGLGWEIISNKMTYTIKDTQIPRKLNEPGYV
RRVSWDDKEFKELHTKFAEKTHGCLYRNNLAWEEYWRWDEDDTSVAIYYSKDDVPYGYMV
YMISSDVMHVKEMIYLNREAQLGLWEFIHAHDSMIDEVRGNNYYSEPIAFELDDSDIKET
IRPYTMGRIIDIRQFFAKYACDPDEPSVCIRFYIEDDLLAWNNGYFTYLFDNGRCIETEQ
QPDYEVSMSIGTLTTLMLGYKTAEKLHIMDKIQASDEAIEHLDDILFHRIPYVSDYI
Download sequence
Identical sequences C4Z643
gi|238922055|ref|YP_002935569.1| gi|238922055|ref|YP_002935569.1|NC_012780 515620.EUBELI_20290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]