SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922062|ref|YP_002935576.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922062|ref|YP_002935576.1|
Domain Number 1 Region: 360-562
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-22
Family Heat shock protein 90, HSP90, N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 51-105
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000275
Family HD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238922062|ref|YP_002935576.1|
Sequence length 1028
Comment hypothetical protein EUBELI_20297 [Eubacterium eligens ATCC 27750]
Sequence
MSDNNKYIPYKLETHLTEICGEDPIYVNLLDSWHINKKTCLNLLSDVVFNYPHYTKHDIS
HSEAIITNIEMLLGEEAIRSLSPTDTWLLLNAAYLHDLGMVIDNKIIEQNWETQEFQDYL
HRLENSNDSSLSESAKYINSLEKNLKDNKDVRAWPVRVRKAVTIIIADYYRSGHAKESQN
YIQNMKNRLHIDLEYNGLIQHRLILLLSDIAYMHNESSMKILELDYNTNGFNADYAHPRF
VALMLRMGDLLDADNNRFNLGNEIIFGEIPNSSQNHLKKHMSTRHILITPDKIEYRADCA
EAEVYRETRNFLTWLKEEVEFWALNWKDIMPENINGSAPKLGKCELLLKGVPDIQGLSDL
RFSMSSEKAFEIIEGANIYDDNFIFLREVIQNALDACKIRMWRDISEGHYKSWIKNKVDS
SLQPYDINQKVMNNYGVEINLTKYDKHNIKIIIKDNGIGISIPQFKKICNVGESYSNDKA
KKNEISGMPKWLKPTAGFGIGLQSVFLVADYFEIYSKADNEEGIYARVESGRKKGYVQLS
KSNKLKHQGTEIHVIISKELQYRYSYNSKTSEYIENKYDPFAYEIDPIYYRIWDELRENV
NGTYFPIKLKFDGKEIDTIIGKGFEQLEEKPSDGRYNYSINNYGMKLWDNDTNTSFYIKL
NEYNENYIEQFFFKGMSVKTDSIFGIKGFALKVDFYGLDTKKTLSLDRKRIRREAYNDIQ
IIIDNAFKFYKKKIKDLIFKENNIKEKNLYNQIYVLWCSYDLKEKKELLDNNKQIFDCIT
KTVRVIKNIDNRYSEDEMDFKNIMNDLNNVAFIYNIHDYEEHSSLHGDLVLKTNEIIQVL
NNSESECKFKVIVVDRDFYALFKSEFCSNIQIIQKDDNIVYLKSYSDENKKLPGVLDENT
KDSILRDLVVKNNSPDIIHEFYDGMLRRFILGIDEYPSILSREVPFGIGGDWHRSKGYII
SPVTSIQWEKYALLSKEQFIESISNSEEFQRLVKYVYEHQLDKCNNSQEKIREEYIRLIG
DIYDACSK
Download sequence
Identical sequences C4Z650
gi|238922062|ref|YP_002935576.1| gi|238922062|ref|YP_002935576.1|NC_012780 515620.EUBELI_20297 WP_012740570.1.74791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]