SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922142|ref|YP_002935656.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922142|ref|YP_002935656.1|
Domain Number 1 Region: 11-108,139-157
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0000672
Family Acetylhydrolase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|238922142|ref|YP_002935656.1|
Sequence length 167
Comment hypothetical protein EUBELI_20377 [Eubacterium eligens ATCC 27750]
Sequence
MYINAWTRVIPKAAYDHCNDILILEMGSNGGWENDYDELIKQYQNIIDNSYYADYIIVGD
TDNPGESADIYQDIYDNNGNYAGLHATLWEQALYDAFGEHFLNTRLYLMENALSDCGLTP
TENDIIDIQTGNLPEQLRADFTHFNSYGYYSKAKAIYLKGIELGYWN
Download sequence
Identical sequences C4Z6D0
gi|238922142|ref|YP_002935656.1|NC_012780 gi|238922142|ref|YP_002935656.1| WP_012740650.1.74791 515620.EUBELI_20377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]