SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238922188|ref|YP_002935702.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238922188|ref|YP_002935702.1|
Domain Number 1 Region: 15-207
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 5.89e-22
Family Archaeal IMP cyclohydrolase PurO 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238922188|ref|YP_002935702.1|
Sequence length 239
Comment hypothetical protein EUBELI_20423 [Eubacterium eligens ATCC 27750]
Sequence
MTIKNLSEELSGCAYPGRGIVAGMSEDGKKAVSAYFIMGRSESSRNRVFVQDGEGIRTEA
FDPSTLLVAPELIIYAPVRVLGNNTIVTNGDQTDTVYDGLSEGKTFEESLRVRKYEHDAP
NYTPRISSVLHVENNEYSYAMSILKSHNGNPDICERHTYTYDAAFAGEGHYIHTYMGDGN
PLPSYEGEPTWVKISGDIEEFTQMIWDNLNADNKVSLFVRYIDIATGEYETRIINKNVK
Download sequence
Identical sequences C4Z6H6
gi|238922188|ref|YP_002935702.1|NC_012780 WP_012740696.1.74791 515620.EUBELI_20423 gi|238922188|ref|YP_002935702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]